Comparison of safety and immunogenicity of a Vi polysaccharide typhoid vaccine with a whole-cell killed vaccine in Malaysian Air Force recruits.
The study reaffirms the safety and efficacy of the Vi polysaccharide vaccine and identifies a hitherto unrecognized advantage in its use, i.e. it is a potent immunogen that boosted considerably the protective antibody levels among a significant number of immunologically sensitized individuals living...
| Main Authors: | , , , , , , , , , , |
|---|---|
| Format: | Article |
| Published: |
2001
|
| Subjects: |
| _version_ | 1796944634788708352 |
|---|---|
| author | Panchanathan, V. Kumar, S. Yeap, W. Devi, S. Ismail, R. Sarijan, S. Sam, S.M. Jusoh, Z. Nordin, S. Leboulleux, D. Pang, T. |
| author_facet | Panchanathan, V. Kumar, S. Yeap, W. Devi, S. Ismail, R. Sarijan, S. Sam, S.M. Jusoh, Z. Nordin, S. Leboulleux, D. Pang, T. |
| author_sort | Panchanathan, V. |
| collection | UM |
| description | The study reaffirms the safety and efficacy of the Vi polysaccharide vaccine and identifies a hitherto unrecognized advantage in its use, i.e. it is a potent immunogen that boosted considerably the protective antibody levels among a significant number of immunologically sensitized individuals living in typhoid-endemic regions. |
| first_indexed | 2024-03-06T05:04:42Z |
| format | Article |
| id | um.eprints-442 |
| institution | Universiti Malaya |
| last_indexed | 2024-03-06T05:04:42Z |
| publishDate | 2001 |
| record_format | dspace |
| spelling | um.eprints-4422014-10-20T06:28:05Z http://eprints.um.edu.my/442/ Comparison of safety and immunogenicity of a Vi polysaccharide typhoid vaccine with a whole-cell killed vaccine in Malaysian Air Force recruits. Panchanathan, V. Kumar, S. Yeap, W. Devi, S. Ismail, R. Sarijan, S. Sam, S.M. Jusoh, Z. Nordin, S. Leboulleux, D. Pang, T. R Medicine (General) The study reaffirms the safety and efficacy of the Vi polysaccharide vaccine and identifies a hitherto unrecognized advantage in its use, i.e. it is a potent immunogen that boosted considerably the protective antibody levels among a significant number of immunologically sensitized individuals living in typhoid-endemic regions. 2001 Article PeerReviewed Panchanathan, V. and Kumar, S. and Yeap, W. and Devi, S. and Ismail, R. and Sarijan, S. and Sam, S.M. and Jusoh, Z. and Nordin, S. and Leboulleux, D. and Pang, T. (2001) Comparison of safety and immunogenicity of a Vi polysaccharide typhoid vaccine with a whole-cell killed vaccine in Malaysian Air Force recruits. Bulletin of the World Health Organization, 79 (9). pp. 811-7. ISSN 0042-9686, DOI 11584728. http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2566659/?tool=pubmed 11584728 |
| spellingShingle | R Medicine (General) Panchanathan, V. Kumar, S. Yeap, W. Devi, S. Ismail, R. Sarijan, S. Sam, S.M. Jusoh, Z. Nordin, S. Leboulleux, D. Pang, T. Comparison of safety and immunogenicity of a Vi polysaccharide typhoid vaccine with a whole-cell killed vaccine in Malaysian Air Force recruits. |
| title | Comparison of safety and immunogenicity of a Vi polysaccharide typhoid vaccine with a whole-cell killed vaccine in Malaysian Air Force recruits. |
| title_full | Comparison of safety and immunogenicity of a Vi polysaccharide typhoid vaccine with a whole-cell killed vaccine in Malaysian Air Force recruits. |
| title_fullStr | Comparison of safety and immunogenicity of a Vi polysaccharide typhoid vaccine with a whole-cell killed vaccine in Malaysian Air Force recruits. |
| title_full_unstemmed | Comparison of safety and immunogenicity of a Vi polysaccharide typhoid vaccine with a whole-cell killed vaccine in Malaysian Air Force recruits. |
| title_short | Comparison of safety and immunogenicity of a Vi polysaccharide typhoid vaccine with a whole-cell killed vaccine in Malaysian Air Force recruits. |
| title_sort | comparison of safety and immunogenicity of a vi polysaccharide typhoid vaccine with a whole cell killed vaccine in malaysian air force recruits |
| topic | R Medicine (General) |
| work_keys_str_mv | AT panchanathanv comparisonofsafetyandimmunogenicityofavipolysaccharidetyphoidvaccinewithawholecellkilledvaccineinmalaysianairforcerecruits AT kumars comparisonofsafetyandimmunogenicityofavipolysaccharidetyphoidvaccinewithawholecellkilledvaccineinmalaysianairforcerecruits AT yeapw comparisonofsafetyandimmunogenicityofavipolysaccharidetyphoidvaccinewithawholecellkilledvaccineinmalaysianairforcerecruits AT devis comparisonofsafetyandimmunogenicityofavipolysaccharidetyphoidvaccinewithawholecellkilledvaccineinmalaysianairforcerecruits AT ismailr comparisonofsafetyandimmunogenicityofavipolysaccharidetyphoidvaccinewithawholecellkilledvaccineinmalaysianairforcerecruits AT sarijans comparisonofsafetyandimmunogenicityofavipolysaccharidetyphoidvaccinewithawholecellkilledvaccineinmalaysianairforcerecruits AT samsm comparisonofsafetyandimmunogenicityofavipolysaccharidetyphoidvaccinewithawholecellkilledvaccineinmalaysianairforcerecruits AT jusohz comparisonofsafetyandimmunogenicityofavipolysaccharidetyphoidvaccinewithawholecellkilledvaccineinmalaysianairforcerecruits AT nordins comparisonofsafetyandimmunogenicityofavipolysaccharidetyphoidvaccinewithawholecellkilledvaccineinmalaysianairforcerecruits AT leboulleuxd comparisonofsafetyandimmunogenicityofavipolysaccharidetyphoidvaccinewithawholecellkilledvaccineinmalaysianairforcerecruits AT pangt comparisonofsafetyandimmunogenicityofavipolysaccharidetyphoidvaccinewithawholecellkilledvaccineinmalaysianairforcerecruits |