Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapour deposition
Single-walled carbon nanotubes (SWCNTs) were synthesized by catalytic chemical vapor deposition (CCVD) of ethanol (C2H5OH) over Fe-Mo-MgO catalyst by using argon as a carrier gas. The reaction conditions are important factors that influence the yield and quality of carbon nanotubes. The effects of t...
| Main Authors: | , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Penerbit Universiti Kebangsaan Malaysia
2011
|
| Online Access: | http://psasir.upm.edu.my/id/eprint/22760/1/Effect%20of%20synthesis%20condition%20on%20the%20growth%20of%20SWCNTs%20via%20catalytic%20chemical%20vapour%20deposition.pdf |
| _version_ | 1796970225722195968 |
|---|---|
| author | Toussi, Setareh Monshi Ahmadun, Fakhru'l-Razi Abdullah, Luqman Chuah Abdul Rashid, Suraya |
| author_facet | Toussi, Setareh Monshi Ahmadun, Fakhru'l-Razi Abdullah, Luqman Chuah Abdul Rashid, Suraya |
| author_sort | Toussi, Setareh Monshi |
| collection | UPM |
| description | Single-walled carbon nanotubes (SWCNTs) were synthesized by catalytic chemical vapor deposition (CCVD) of ethanol (C2H5OH) over Fe-Mo-MgO catalyst by using argon as a carrier gas. The reaction conditions are important factors that influence the yield and quality of carbon nanotubes. The effects of temperature and flow rate of carrier gas were investigated to increase the yield of carbon nanotubes. The synthesized carbon nanotubes were characterized by scanning electron microscopy, transmission electron microscopy, X-Ray diffraction and thermo-gravimetric analysis. The results showed that the growth of carbon nanotubes was effectively influenced by the reaction ambience and the synthesis condition. The temperature and flow rate of carrier gas played a key role in the yield and quality of synthesized CNTs. The estimated yield of synthesized carbon nanotubes was almost over 70%. |
| first_indexed | 2024-03-06T07:54:54Z |
| format | Article |
| id | upm.eprints-22760 |
| institution | Universiti Putra Malaysia |
| language | English |
| last_indexed | 2024-03-06T07:54:54Z |
| publishDate | 2011 |
| publisher | Penerbit Universiti Kebangsaan Malaysia |
| record_format | dspace |
| spelling | upm.eprints-227602020-04-15T16:28:13Z http://psasir.upm.edu.my/id/eprint/22760/ Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapour deposition Toussi, Setareh Monshi Ahmadun, Fakhru'l-Razi Abdullah, Luqman Chuah Abdul Rashid, Suraya Single-walled carbon nanotubes (SWCNTs) were synthesized by catalytic chemical vapor deposition (CCVD) of ethanol (C2H5OH) over Fe-Mo-MgO catalyst by using argon as a carrier gas. The reaction conditions are important factors that influence the yield and quality of carbon nanotubes. The effects of temperature and flow rate of carrier gas were investigated to increase the yield of carbon nanotubes. The synthesized carbon nanotubes were characterized by scanning electron microscopy, transmission electron microscopy, X-Ray diffraction and thermo-gravimetric analysis. The results showed that the growth of carbon nanotubes was effectively influenced by the reaction ambience and the synthesis condition. The temperature and flow rate of carrier gas played a key role in the yield and quality of synthesized CNTs. The estimated yield of synthesized carbon nanotubes was almost over 70%. Penerbit Universiti Kebangsaan Malaysia 2011 Article PeerReviewed text en http://psasir.upm.edu.my/id/eprint/22760/1/Effect%20of%20synthesis%20condition%20on%20the%20growth%20of%20SWCNTs%20via%20catalytic%20chemical%20vapour%20deposition.pdf Toussi, Setareh Monshi and Ahmadun, Fakhru'l-Razi and Abdullah, Luqman Chuah and Abdul Rashid, Suraya (2011) Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapour deposition. Sains Malaysiana, 40 (3). pp. 197-201. ISSN 0126-6039 http://www.ukm.edu.my/jsm/english_journals/vol40num3_2011/contentsVol40num3_2011.html |
| spellingShingle | Toussi, Setareh Monshi Ahmadun, Fakhru'l-Razi Abdullah, Luqman Chuah Abdul Rashid, Suraya Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapour deposition |
| title | Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapour deposition |
| title_full | Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapour deposition |
| title_fullStr | Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapour deposition |
| title_full_unstemmed | Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapour deposition |
| title_short | Effect of synthesis condition on the growth of SWCNTs via catalytic chemical vapour deposition |
| title_sort | effect of synthesis condition on the growth of swcnts via catalytic chemical vapour deposition |
| url | http://psasir.upm.edu.my/id/eprint/22760/1/Effect%20of%20synthesis%20condition%20on%20the%20growth%20of%20SWCNTs%20via%20catalytic%20chemical%20vapour%20deposition.pdf |
| work_keys_str_mv | AT toussisetarehmonshi effectofsynthesisconditiononthegrowthofswcntsviacatalyticchemicalvapourdeposition AT ahmadunfakhrulrazi effectofsynthesisconditiononthegrowthofswcntsviacatalyticchemicalvapourdeposition AT abdullahluqmanchuah effectofsynthesisconditiononthegrowthofswcntsviacatalyticchemicalvapourdeposition AT abdulrashidsuraya effectofsynthesisconditiononthegrowthofswcntsviacatalyticchemicalvapourdeposition |