'Candidatus Phytoplasma malaysianum', a novel taxon associated with virescence and phyllody of Madagascar periwinkle (Catharanthus roseus).
This study addressed the taxonomic position and group classification of a phytoplasma responsible for virescence and phyllody symptoms in naturally diseased Madagascar periwinkle plants in western Malaysia. Unique regions in the 16S rRNA gene from the Malaysian periwinkle virescence (MaPV) phytoplas...
| Main Authors: | , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English English |
| Published: |
International Union of Microbiological Societies
2013
|
| Online Access: | http://psasir.upm.edu.my/id/eprint/29502/1/%27Candidatus%20Phytoplasma%20malaysianum%27.pdf |
| _version_ | 1825947524098162688 |
|---|---|
| author | Nejat, Naghmeh Vadamalai, Ganesan Davis, Robert E. Harrison, Nigel A. Sijam, Kamaruzaman Dickinson, Matthew Abdullah, Siti Nor Akmar Zhao, Yan |
| author_facet | Nejat, Naghmeh Vadamalai, Ganesan Davis, Robert E. Harrison, Nigel A. Sijam, Kamaruzaman Dickinson, Matthew Abdullah, Siti Nor Akmar Zhao, Yan |
| author_sort | Nejat, Naghmeh |
| collection | UPM |
| description | This study addressed the taxonomic position and group classification of a phytoplasma responsible for virescence and phyllody symptoms in naturally diseased Madagascar periwinkle plants in western Malaysia. Unique regions in the 16S rRNA gene from the Malaysian periwinkle virescence (MaPV) phytoplasma distinguished the phytoplasma from all previously described 'Candidatus Phytoplasma' species. Pairwise sequence similarity scores, calculated through alignment of full-length 16S rRNA gene sequences, revealed that the MaPV phytoplasma 16S rRNA gene shared 96.5 % or less sequence similarity with that of previously described 'Ca. Phytoplasma' species, justifying the recognition of the MaPV phytoplasma as a reference strain of a novel taxon, 'Candidatus Phytoplasma malaysianum'. The 16S rRNA gene F2nR2 fragment from the MaPV phytoplasma exhibited a distinct restriction fragment length polymorphism (RFLP) profile and the pattern similarity coefficient values were lower than 0.85 with representative phytoplasmas classified in any of the 31 previously delineated 16Sr groups; therefore, the MaPV phytoplasma was designated a member of a new 16Sr group, 16SrXXXII. Phytoplasmas affiliated with this novel taxon and the new group included diverse strains infecting periwinkle, coconut palm and oil palm in Malaysia. Three phytoplasmas were characterized as representatives of three distinct subgroups, 16SrXXXII-A, 16SrXXXII-B and 16SrXXXII-C, respectively. |
| first_indexed | 2024-03-06T08:14:41Z |
| format | Article |
| id | upm.eprints-29502 |
| institution | Universiti Putra Malaysia |
| language | English English |
| last_indexed | 2024-03-06T08:14:41Z |
| publishDate | 2013 |
| publisher | International Union of Microbiological Societies |
| record_format | dspace |
| spelling | upm.eprints-295022015-12-07T08:29:20Z http://psasir.upm.edu.my/id/eprint/29502/ 'Candidatus Phytoplasma malaysianum', a novel taxon associated with virescence and phyllody of Madagascar periwinkle (Catharanthus roseus). Nejat, Naghmeh Vadamalai, Ganesan Davis, Robert E. Harrison, Nigel A. Sijam, Kamaruzaman Dickinson, Matthew Abdullah, Siti Nor Akmar Zhao, Yan This study addressed the taxonomic position and group classification of a phytoplasma responsible for virescence and phyllody symptoms in naturally diseased Madagascar periwinkle plants in western Malaysia. Unique regions in the 16S rRNA gene from the Malaysian periwinkle virescence (MaPV) phytoplasma distinguished the phytoplasma from all previously described 'Candidatus Phytoplasma' species. Pairwise sequence similarity scores, calculated through alignment of full-length 16S rRNA gene sequences, revealed that the MaPV phytoplasma 16S rRNA gene shared 96.5 % or less sequence similarity with that of previously described 'Ca. Phytoplasma' species, justifying the recognition of the MaPV phytoplasma as a reference strain of a novel taxon, 'Candidatus Phytoplasma malaysianum'. The 16S rRNA gene F2nR2 fragment from the MaPV phytoplasma exhibited a distinct restriction fragment length polymorphism (RFLP) profile and the pattern similarity coefficient values were lower than 0.85 with representative phytoplasmas classified in any of the 31 previously delineated 16Sr groups; therefore, the MaPV phytoplasma was designated a member of a new 16Sr group, 16SrXXXII. Phytoplasmas affiliated with this novel taxon and the new group included diverse strains infecting periwinkle, coconut palm and oil palm in Malaysia. Three phytoplasmas were characterized as representatives of three distinct subgroups, 16SrXXXII-A, 16SrXXXII-B and 16SrXXXII-C, respectively. International Union of Microbiological Societies 2013 Article PeerReviewed application/pdf en http://psasir.upm.edu.my/id/eprint/29502/1/%27Candidatus%20Phytoplasma%20malaysianum%27.pdf Nejat, Naghmeh and Vadamalai, Ganesan and Davis, Robert E. and Harrison, Nigel A. and Sijam, Kamaruzaman and Dickinson, Matthew and Abdullah, Siti Nor Akmar and Zhao, Yan (2013) 'Candidatus Phytoplasma malaysianum', a novel taxon associated with virescence and phyllody of Madagascar periwinkle (Catharanthus roseus). International Journal of Systematic and Evolutionary Microbiology, 63 (pt.2). pp. 540-548. ISSN 1466-5026; ESSN : 1466-5034 http://ijs.sgmjournals.org/content/63/Pt_2.toc 10.1099/ijs.0.041467-0 English |
| spellingShingle | Nejat, Naghmeh Vadamalai, Ganesan Davis, Robert E. Harrison, Nigel A. Sijam, Kamaruzaman Dickinson, Matthew Abdullah, Siti Nor Akmar Zhao, Yan 'Candidatus Phytoplasma malaysianum', a novel taxon associated with virescence and phyllody of Madagascar periwinkle (Catharanthus roseus). |
| title | 'Candidatus Phytoplasma malaysianum', a novel taxon associated with virescence and phyllody of Madagascar periwinkle (Catharanthus roseus). |
| title_full | 'Candidatus Phytoplasma malaysianum', a novel taxon associated with virescence and phyllody of Madagascar periwinkle (Catharanthus roseus). |
| title_fullStr | 'Candidatus Phytoplasma malaysianum', a novel taxon associated with virescence and phyllody of Madagascar periwinkle (Catharanthus roseus). |
| title_full_unstemmed | 'Candidatus Phytoplasma malaysianum', a novel taxon associated with virescence and phyllody of Madagascar periwinkle (Catharanthus roseus). |
| title_short | 'Candidatus Phytoplasma malaysianum', a novel taxon associated with virescence and phyllody of Madagascar periwinkle (Catharanthus roseus). |
| title_sort | candidatus phytoplasma malaysianum a novel taxon associated with virescence and phyllody of madagascar periwinkle catharanthus roseus |
| url | http://psasir.upm.edu.my/id/eprint/29502/1/%27Candidatus%20Phytoplasma%20malaysianum%27.pdf |
| work_keys_str_mv | AT nejatnaghmeh candidatusphytoplasmamalaysianumanoveltaxonassociatedwithvirescenceandphyllodyofmadagascarperiwinklecatharanthusroseus AT vadamalaiganesan candidatusphytoplasmamalaysianumanoveltaxonassociatedwithvirescenceandphyllodyofmadagascarperiwinklecatharanthusroseus AT davisroberte candidatusphytoplasmamalaysianumanoveltaxonassociatedwithvirescenceandphyllodyofmadagascarperiwinklecatharanthusroseus AT harrisonnigela candidatusphytoplasmamalaysianumanoveltaxonassociatedwithvirescenceandphyllodyofmadagascarperiwinklecatharanthusroseus AT sijamkamaruzaman candidatusphytoplasmamalaysianumanoveltaxonassociatedwithvirescenceandphyllodyofmadagascarperiwinklecatharanthusroseus AT dickinsonmatthew candidatusphytoplasmamalaysianumanoveltaxonassociatedwithvirescenceandphyllodyofmadagascarperiwinklecatharanthusroseus AT abdullahsitinorakmar candidatusphytoplasmamalaysianumanoveltaxonassociatedwithvirescenceandphyllodyofmadagascarperiwinklecatharanthusroseus AT zhaoyan candidatusphytoplasmamalaysianumanoveltaxonassociatedwithvirescenceandphyllodyofmadagascarperiwinklecatharanthusroseus |