Antibody responses in chickens experimentally infected with low and high passaged chicken anemia virus isolates
It has been shown that chicken anemia virus (CAV) which had undergone 60 and 123 passages in cell cultures (SMSC-1IP60, SMSC-I/P123, 3-1IP60 and 3-l/P123) were less pathogenic compared to low passaged CAY (SMSC- 1 and 3-1) isolates. In this study, the ability of the isolates to induce antibody respo...
Main Authors: | , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Veterinary Association Malaysia
2005
|
Online Access: | http://psasir.upm.edu.my/id/eprint/41534/1/0001.pdf |
_version_ | 1825928978511167488 |
---|---|
author | Chowdhury, Shah Md. Ziqrul Haq Omar, Abdul Rahman Ideris, Aini Darus, Azizah Kono, Yuji |
author_facet | Chowdhury, Shah Md. Ziqrul Haq Omar, Abdul Rahman Ideris, Aini Darus, Azizah Kono, Yuji |
author_sort | Chowdhury, Shah Md. Ziqrul Haq |
collection | UPM |
description | It has been shown that chicken anemia virus (CAV) which had undergone 60 and 123 passages in cell cultures (SMSC-1IP60, SMSC-I/P123, 3-1IP60 and 3-l/P123) were less pathogenic compared to low passaged CAY (SMSC- 1 and 3-1) isolates. In this study, the ability of the isolates to induce antibody responses was studied using enzymelinked immunosorbent assay (ELISA). All the isolates regardless of the number of cell culture passages that they had undergone elicited CAY antibody responses both at 16 and 30 days post inoculation. A CAY isolate, BL-5 that was not passaged in cell culture elicited higher antibody response than the cell culture passaged isolates. However, the differences in the average ELISA titres and the percentage of positive sera between the isolates were not statistically significant (P>0.05). The study showed that CAY isolates which had undergone repeated passages in cell culture are still immunogenic
|
first_indexed | 2024-03-06T08:50:10Z |
format | Article |
id | upm.eprints-41534 |
institution | Universiti Putra Malaysia |
language | English |
last_indexed | 2024-03-06T08:50:10Z |
publishDate | 2005 |
publisher | Veterinary Association Malaysia |
record_format | dspace |
spelling | upm.eprints-415342015-12-22T00:37:17Z http://psasir.upm.edu.my/id/eprint/41534/ Antibody responses in chickens experimentally infected with low and high passaged chicken anemia virus isolates Chowdhury, Shah Md. Ziqrul Haq Omar, Abdul Rahman Ideris, Aini Darus, Azizah Kono, Yuji It has been shown that chicken anemia virus (CAV) which had undergone 60 and 123 passages in cell cultures (SMSC-1IP60, SMSC-I/P123, 3-1IP60 and 3-l/P123) were less pathogenic compared to low passaged CAY (SMSC- 1 and 3-1) isolates. In this study, the ability of the isolates to induce antibody responses was studied using enzymelinked immunosorbent assay (ELISA). All the isolates regardless of the number of cell culture passages that they had undergone elicited CAY antibody responses both at 16 and 30 days post inoculation. A CAY isolate, BL-5 that was not passaged in cell culture elicited higher antibody response than the cell culture passaged isolates. However, the differences in the average ELISA titres and the percentage of positive sera between the isolates were not statistically significant (P>0.05). The study showed that CAY isolates which had undergone repeated passages in cell culture are still immunogenic Veterinary Association Malaysia 2005-07 Article PeerReviewed application/pdf en http://psasir.upm.edu.my/id/eprint/41534/1/0001.pdf Chowdhury, Shah Md. Ziqrul Haq and Omar, Abdul Rahman and Ideris, Aini and Darus, Azizah and Kono, Yuji (2005) Antibody responses in chickens experimentally infected with low and high passaged chicken anemia virus isolates. Jurnal Veterinar Malaysia, 17 (1). pp. 13-17. ISSN 9128-2506 |
spellingShingle | Chowdhury, Shah Md. Ziqrul Haq Omar, Abdul Rahman Ideris, Aini Darus, Azizah Kono, Yuji Antibody responses in chickens experimentally infected with low and high passaged chicken anemia virus isolates |
title | Antibody responses in chickens experimentally infected with low and high passaged chicken anemia virus isolates |
title_full | Antibody responses in chickens experimentally infected with low and high passaged chicken anemia virus isolates |
title_fullStr | Antibody responses in chickens experimentally infected with low and high passaged chicken anemia virus isolates |
title_full_unstemmed | Antibody responses in chickens experimentally infected with low and high passaged chicken anemia virus isolates |
title_short | Antibody responses in chickens experimentally infected with low and high passaged chicken anemia virus isolates |
title_sort | antibody responses in chickens experimentally infected with low and high passaged chicken anemia virus isolates |
url | http://psasir.upm.edu.my/id/eprint/41534/1/0001.pdf |
work_keys_str_mv | AT chowdhuryshahmdziqrulhaq antibodyresponsesinchickensexperimentallyinfectedwithlowandhighpassagedchickenanemiavirusisolates AT omarabdulrahman antibodyresponsesinchickensexperimentallyinfectedwithlowandhighpassagedchickenanemiavirusisolates AT iderisaini antibodyresponsesinchickensexperimentallyinfectedwithlowandhighpassagedchickenanemiavirusisolates AT darusazizah antibodyresponsesinchickensexperimentallyinfectedwithlowandhighpassagedchickenanemiavirusisolates AT konoyuji antibodyresponsesinchickensexperimentallyinfectedwithlowandhighpassagedchickenanemiavirusisolates |