In-silico analysis and mRNA modulation of detoxification enzymes GST delta and kappa against various biotic and abiotic oxidative stressors
This study reports the comprehensive comparative information of two different detoxification enzymes such as glutathione S-transferases (GSTs) delta and kappa from freshwater giant prawn Macrobrachium rosenbergii (designated as MrGSTD and MrGSTK) by investigating their in-silico characters and mRNA...
| Main Authors: | , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Elsevier
2016
|
| Subjects: | |
| Online Access: | http://psasir.upm.edu.my/id/eprint/54578/1/In-silico%20analysis%20and%20mRNA%20modulation%20of%20detoxification%20enzymes%20GST%20delta%20.pdf |
| _version_ | 1825931065228787712 |
|---|---|
| author | Chaurasia, Mukesh Kumar Ravichandran, Gayathri Nizam, Faizal Arasu, Mariadhas Valan Al-Dhabi, Naif Abdullah Arshad, Aziz Harikrishnan, Ramasamy Arockiaraj, Jesu |
| author_facet | Chaurasia, Mukesh Kumar Ravichandran, Gayathri Nizam, Faizal Arasu, Mariadhas Valan Al-Dhabi, Naif Abdullah Arshad, Aziz Harikrishnan, Ramasamy Arockiaraj, Jesu |
| author_sort | Chaurasia, Mukesh Kumar |
| collection | UPM |
| description | This study reports the comprehensive comparative information of two different detoxification enzymes such as glutathione S-transferases (GSTs) delta and kappa from freshwater giant prawn Macrobrachium rosenbergii (designated as MrGSTD and MrGSTK) by investigating their in-silico characters and mRNA modulation against various biotic and abiotic oxidative stressors. The physico-chemical properties of these cDNA and their polypeptide structure were analyzed using various bioinformatics program. The analysis indicated the variation in size of the polypeptides, presence or absence of domains and motifs and structure. Homology and phylogenetic analysis revealed that MrGSTD shared maximum identity (83%) with crustaceans GST delta, whereas MrGSTK fell in arthropods GST kappa. It is interesting to note that MrGSTD and MrGSTK shared only 21% identity; it indicated their structural difference. Structural analysis indicated that MrGSTD to be canonical dimer like shape and MrGSTK appeared to be butterfly dimer like shape, in spite of four β-sheets being conserved in both GSTs. Tissue specific gene expression analysis showed that both MrGSTD and MrGSTK are highly expressed in immune organs such as haemocyte and hepatopancreas, respectively. To understand the role of mRNA modulation of MrGSTD and MrGSTK, the prawns were inducted with oxidative stressors such as bacteria (Vibrio harveyi), virus [white spot syndrome virus (WSSV)] and heavy metal, cadmium (Cd). The analysis revealed an interesting fact that both MrGSTD and MrGSTK showed higher (P < 0.05) up-regulation at 48 h post-challenge, except MrGSTD stressed with bacteria, where it showed up-regulation at 24 h post-challenge. Overall, the results suggested that GSTs are diverse in their structure and possibly conferring their potential involvement in immune protection in crustaceans. However, further study is necessary to focus their functional differences at proteomic level. |
| first_indexed | 2024-03-06T09:21:05Z |
| format | Article |
| id | upm.eprints-54578 |
| institution | Universiti Putra Malaysia |
| language | English |
| last_indexed | 2024-03-06T09:21:05Z |
| publishDate | 2016 |
| publisher | Elsevier |
| record_format | dspace |
| spelling | upm.eprints-545782018-03-30T02:33:18Z http://psasir.upm.edu.my/id/eprint/54578/ In-silico analysis and mRNA modulation of detoxification enzymes GST delta and kappa against various biotic and abiotic oxidative stressors Chaurasia, Mukesh Kumar Ravichandran, Gayathri Nizam, Faizal Arasu, Mariadhas Valan Al-Dhabi, Naif Abdullah Arshad, Aziz Harikrishnan, Ramasamy Arockiaraj, Jesu This study reports the comprehensive comparative information of two different detoxification enzymes such as glutathione S-transferases (GSTs) delta and kappa from freshwater giant prawn Macrobrachium rosenbergii (designated as MrGSTD and MrGSTK) by investigating their in-silico characters and mRNA modulation against various biotic and abiotic oxidative stressors. The physico-chemical properties of these cDNA and their polypeptide structure were analyzed using various bioinformatics program. The analysis indicated the variation in size of the polypeptides, presence or absence of domains and motifs and structure. Homology and phylogenetic analysis revealed that MrGSTD shared maximum identity (83%) with crustaceans GST delta, whereas MrGSTK fell in arthropods GST kappa. It is interesting to note that MrGSTD and MrGSTK shared only 21% identity; it indicated their structural difference. Structural analysis indicated that MrGSTD to be canonical dimer like shape and MrGSTK appeared to be butterfly dimer like shape, in spite of four β-sheets being conserved in both GSTs. Tissue specific gene expression analysis showed that both MrGSTD and MrGSTK are highly expressed in immune organs such as haemocyte and hepatopancreas, respectively. To understand the role of mRNA modulation of MrGSTD and MrGSTK, the prawns were inducted with oxidative stressors such as bacteria (Vibrio harveyi), virus [white spot syndrome virus (WSSV)] and heavy metal, cadmium (Cd). The analysis revealed an interesting fact that both MrGSTD and MrGSTK showed higher (P < 0.05) up-regulation at 48 h post-challenge, except MrGSTD stressed with bacteria, where it showed up-regulation at 24 h post-challenge. Overall, the results suggested that GSTs are diverse in their structure and possibly conferring their potential involvement in immune protection in crustaceans. However, further study is necessary to focus their functional differences at proteomic level. Elsevier 2016-07 Article PeerReviewed text en http://psasir.upm.edu.my/id/eprint/54578/1/In-silico%20analysis%20and%20mRNA%20modulation%20of%20detoxification%20enzymes%20GST%20delta%20.pdf Chaurasia, Mukesh Kumar and Ravichandran, Gayathri and Nizam, Faizal and Arasu, Mariadhas Valan and Al-Dhabi, Naif Abdullah and Arshad, Aziz and Harikrishnan, Ramasamy and Arockiaraj, Jesu (2016) In-silico analysis and mRNA modulation of detoxification enzymes GST delta and kappa against various biotic and abiotic oxidative stressors. Fish & Shellfish Immunology, 54. 353 - 363. ISSN 1050-4648; ESSN: 1095-9947 https://www.sciencedirect.com/science/article/pii/S1050464816301826?via%3Dihub GST; Prawn; Gene expression; Pathogen; Heavy metal 10.1016/j.fsi.2016.04.031 |
| spellingShingle | GST; Prawn; Gene expression; Pathogen; Heavy metal Chaurasia, Mukesh Kumar Ravichandran, Gayathri Nizam, Faizal Arasu, Mariadhas Valan Al-Dhabi, Naif Abdullah Arshad, Aziz Harikrishnan, Ramasamy Arockiaraj, Jesu In-silico analysis and mRNA modulation of detoxification enzymes GST delta and kappa against various biotic and abiotic oxidative stressors |
| title | In-silico analysis and mRNA modulation of detoxification enzymes GST delta and kappa against various biotic and abiotic oxidative stressors |
| title_full | In-silico analysis and mRNA modulation of detoxification enzymes GST delta and kappa against various biotic and abiotic oxidative stressors |
| title_fullStr | In-silico analysis and mRNA modulation of detoxification enzymes GST delta and kappa against various biotic and abiotic oxidative stressors |
| title_full_unstemmed | In-silico analysis and mRNA modulation of detoxification enzymes GST delta and kappa against various biotic and abiotic oxidative stressors |
| title_short | In-silico analysis and mRNA modulation of detoxification enzymes GST delta and kappa against various biotic and abiotic oxidative stressors |
| title_sort | in silico analysis and mrna modulation of detoxification enzymes gst delta and kappa against various biotic and abiotic oxidative stressors |
| topic | GST; Prawn; Gene expression; Pathogen; Heavy metal |
| url | http://psasir.upm.edu.my/id/eprint/54578/1/In-silico%20analysis%20and%20mRNA%20modulation%20of%20detoxification%20enzymes%20GST%20delta%20.pdf |
| work_keys_str_mv | AT chaurasiamukeshkumar insilicoanalysisandmrnamodulationofdetoxificationenzymesgstdeltaandkappaagainstvariousbioticandabioticoxidativestressors AT ravichandrangayathri insilicoanalysisandmrnamodulationofdetoxificationenzymesgstdeltaandkappaagainstvariousbioticandabioticoxidativestressors AT nizamfaizal insilicoanalysisandmrnamodulationofdetoxificationenzymesgstdeltaandkappaagainstvariousbioticandabioticoxidativestressors AT arasumariadhasvalan insilicoanalysisandmrnamodulationofdetoxificationenzymesgstdeltaandkappaagainstvariousbioticandabioticoxidativestressors AT aldhabinaifabdullah insilicoanalysisandmrnamodulationofdetoxificationenzymesgstdeltaandkappaagainstvariousbioticandabioticoxidativestressors AT arshadaziz insilicoanalysisandmrnamodulationofdetoxificationenzymesgstdeltaandkappaagainstvariousbioticandabioticoxidativestressors AT harikrishnanramasamy insilicoanalysisandmrnamodulationofdetoxificationenzymesgstdeltaandkappaagainstvariousbioticandabioticoxidativestressors AT arockiarajjesu insilicoanalysisandmrnamodulationofdetoxificationenzymesgstdeltaandkappaagainstvariousbioticandabioticoxidativestressors |