Extension of raw milk quality through supplementation of hydrocyanic acid from fresh cassava peel in dairy cattle diet
The objective of this study was to evaluate the effects on the extension of raw milk quality through supplementation of hydrocyanic acid (HCN) levels from fresh cassava peel (FCPe) in dairy cattle diet by increasing the milk thiocyanate (SCN) concentration and lactoperoxidase (LP) activity. The sa...
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Prince of Songkla University
2017-12-01
|
| Series: | Songklanakarin Journal of Science and Technology (SJST) |
| Subjects: | |
| Online Access: | http://rdo.psu.ac.th/sjstweb/journal/39-6/39-6-6.pdf |
| _version_ | 1818318481484939264 |
|---|---|
| author | Supreena Srisaikham Naoki Isobe Wisitiporn Suksombat |
| author_facet | Supreena Srisaikham Naoki Isobe Wisitiporn Suksombat |
| author_sort | Supreena Srisaikham |
| collection | DOAJ |
| description | The objective of this study was to evaluate the effects on the extension of raw milk quality through supplementation of
hydrocyanic acid (HCN) levels from fresh cassava peel (FCPe) in dairy cattle diet by increasing the milk thiocyanate (SCN)
concentration and lactoperoxidase (LP) activity. The sample was twenty-four Holstein Friesian crossbred lactating dairy
cows, averaging 87±31 days in milk (DIM), 13.4±2.9 kg of milk and 397±52 kg body weight (BW). All cows were fed the
control diet with 6.5 kg/d of 21% crude protein (CP) concentrate and ad libitum grass silage (GS). The treatments groups
were as follows: 1) the control diet for the 1st group, the 2nd group received the control diet supplemented with 400 g/d of FCPe
(75 ppm HCN) and the 3rd group received the control diet supplemented with 800 g/d of FCPe (150 ppm HCN). The results
showed that 800 g/h/d FCPe enhanced the efficiency of LP activity in raw milk to reduce total bacterial count (TBC) and
coliform count (CC); therefore, 400 g/h/d FCPe can be used in the concentrate for lactating dairy cows. |
| first_indexed | 2024-12-13T09:53:54Z |
| format | Article |
| id | doaj.art-1b81ba5adfc94391bbdbe6354a7053e5 |
| institution | Directory Open Access Journal |
| issn | 0125-3395 |
| language | English |
| last_indexed | 2024-12-13T09:53:54Z |
| publishDate | 2017-12-01 |
| publisher | Prince of Songkla University |
| record_format | Article |
| series | Songklanakarin Journal of Science and Technology (SJST) |
| spelling | doaj.art-1b81ba5adfc94391bbdbe6354a7053e52022-12-21T23:51:51ZengPrince of Songkla UniversitySongklanakarin Journal of Science and Technology (SJST)0125-33952017-12-0139673974910.14456/sjst-psu.2017.90Extension of raw milk quality through supplementation of hydrocyanic acid from fresh cassava peel in dairy cattle dietSupreena Srisaikham0Naoki Isobe1Wisitiporn Suksombat2Faculty of Agricultural Technology, Burapha University, Sakaeo Campus, Watthana Nakhon, Sakaeo, 27160 ThailandGraduate School of Biosphere Science, Hiroshima University, Higashi-Hiroshima, 739-8528 JapanSchool of Animal Production Technology, Suranaree University of Technology, Mueang, Nakhon Ratchasima, 30000 ThailandThe objective of this study was to evaluate the effects on the extension of raw milk quality through supplementation of hydrocyanic acid (HCN) levels from fresh cassava peel (FCPe) in dairy cattle diet by increasing the milk thiocyanate (SCN) concentration and lactoperoxidase (LP) activity. The sample was twenty-four Holstein Friesian crossbred lactating dairy cows, averaging 87±31 days in milk (DIM), 13.4±2.9 kg of milk and 397±52 kg body weight (BW). All cows were fed the control diet with 6.5 kg/d of 21% crude protein (CP) concentrate and ad libitum grass silage (GS). The treatments groups were as follows: 1) the control diet for the 1st group, the 2nd group received the control diet supplemented with 400 g/d of FCPe (75 ppm HCN) and the 3rd group received the control diet supplemented with 800 g/d of FCPe (150 ppm HCN). The results showed that 800 g/h/d FCPe enhanced the efficiency of LP activity in raw milk to reduce total bacterial count (TBC) and coliform count (CC); therefore, 400 g/h/d FCPe can be used in the concentrate for lactating dairy cows.http://rdo.psu.ac.th/sjstweb/journal/39-6/39-6-6.pdffresh cassava peelhydrocyanic acidmilk thiocyanatelactoperoxidase activitydairy cow’s diet |
| spellingShingle | Supreena Srisaikham Naoki Isobe Wisitiporn Suksombat Extension of raw milk quality through supplementation of hydrocyanic acid from fresh cassava peel in dairy cattle diet Songklanakarin Journal of Science and Technology (SJST) fresh cassava peel hydrocyanic acid milk thiocyanate lactoperoxidase activity dairy cow’s diet |
| title | Extension of raw milk quality through supplementation of hydrocyanic acid from fresh cassava peel in dairy cattle diet |
| title_full | Extension of raw milk quality through supplementation of hydrocyanic acid from fresh cassava peel in dairy cattle diet |
| title_fullStr | Extension of raw milk quality through supplementation of hydrocyanic acid from fresh cassava peel in dairy cattle diet |
| title_full_unstemmed | Extension of raw milk quality through supplementation of hydrocyanic acid from fresh cassava peel in dairy cattle diet |
| title_short | Extension of raw milk quality through supplementation of hydrocyanic acid from fresh cassava peel in dairy cattle diet |
| title_sort | extension of raw milk quality through supplementation of hydrocyanic acid from fresh cassava peel in dairy cattle diet |
| topic | fresh cassava peel hydrocyanic acid milk thiocyanate lactoperoxidase activity dairy cow’s diet |
| url | http://rdo.psu.ac.th/sjstweb/journal/39-6/39-6-6.pdf |
| work_keys_str_mv | AT supreenasrisaikham extensionofrawmilkqualitythroughsupplementationofhydrocyanicacidfromfreshcassavapeelindairycattlediet AT naokiisobe extensionofrawmilkqualitythroughsupplementationofhydrocyanicacidfromfreshcassavapeelindairycattlediet AT wisitipornsuksombat extensionofrawmilkqualitythroughsupplementationofhydrocyanicacidfromfreshcassavapeelindairycattlediet |