Supplementation Strategies to Reduce Muscle Damage and Improve Recovery Following Exercise in Females: A Systematic Review
Exercise-induced muscle damage (EIMD) caused by unaccustomed or strenuous exercise can result in reduced muscle force, increased muscle soreness, increased intramuscular proteins in the blood, and reduced performance. Pre- and post-exercise optimal nutritional intake is important to assist with musc...
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2016-11-01
|
| Series: | Sports |
| Subjects: | |
| Online Access: | http://www.mdpi.com/2075-4663/4/4/51 |
| _version_ | 1798002606125088768 |
|---|---|
| author | Jessica L. Köhne Michael J. Ormsbee Andrew J. McKune |
| author_facet | Jessica L. Köhne Michael J. Ormsbee Andrew J. McKune |
| author_sort | Jessica L. Köhne |
| collection | DOAJ |
| description | Exercise-induced muscle damage (EIMD) caused by unaccustomed or strenuous exercise can result in reduced muscle force, increased muscle soreness, increased intramuscular proteins in the blood, and reduced performance. Pre- and post-exercise optimal nutritional intake is important to assist with muscle-damage repair and reconditioning to allow for an accelerated recovery. The increased demand for training and competing on consecutive days has led to a variety of intervention strategies being used to reduce the negative effects of EIMD. Nutritional intervention strategies are largely tested on male participants, and few report on sex-related differences relating to the effects of the interventions employed. This review focuses on nutritional intervention strategies employed to negate the effects of EIMD, focussing solely on females. |
| first_indexed | 2024-04-11T11:55:00Z |
| format | Article |
| id | doaj.art-305eb6871333485dad4abbed50481e69 |
| institution | Directory Open Access Journal |
| issn | 2075-4663 |
| language | English |
| last_indexed | 2024-04-11T11:55:00Z |
| publishDate | 2016-11-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Sports |
| spelling | doaj.art-305eb6871333485dad4abbed50481e692022-12-22T04:25:11ZengMDPI AGSports2075-46632016-11-01445110.3390/sports4040051sports4040051Supplementation Strategies to Reduce Muscle Damage and Improve Recovery Following Exercise in Females: A Systematic ReviewJessica L. Köhne0Michael J. Ormsbee1Andrew J. McKune2Discipline of Biokinetics, Exercise and Leisure Sciences, School of Health Sciences, University of KwaZulu-Natal, Durban 3629, South AfricaDiscipline of Biokinetics, Exercise and Leisure Sciences, School of Health Sciences, University of KwaZulu-Natal, Durban 3629, South AfricaDiscipline of Biokinetics, Exercise and Leisure Sciences, School of Health Sciences, University of KwaZulu-Natal, Durban 3629, South AfricaExercise-induced muscle damage (EIMD) caused by unaccustomed or strenuous exercise can result in reduced muscle force, increased muscle soreness, increased intramuscular proteins in the blood, and reduced performance. Pre- and post-exercise optimal nutritional intake is important to assist with muscle-damage repair and reconditioning to allow for an accelerated recovery. The increased demand for training and competing on consecutive days has led to a variety of intervention strategies being used to reduce the negative effects of EIMD. Nutritional intervention strategies are largely tested on male participants, and few report on sex-related differences relating to the effects of the interventions employed. This review focuses on nutritional intervention strategies employed to negate the effects of EIMD, focussing solely on females.http://www.mdpi.com/2075-4663/4/4/51EIMDrecoveryproteinblueberriesinflammation |
| spellingShingle | Jessica L. Köhne Michael J. Ormsbee Andrew J. McKune Supplementation Strategies to Reduce Muscle Damage and Improve Recovery Following Exercise in Females: A Systematic Review Sports EIMD recovery protein blueberries inflammation |
| title | Supplementation Strategies to Reduce Muscle Damage and Improve Recovery Following Exercise in Females: A Systematic Review |
| title_full | Supplementation Strategies to Reduce Muscle Damage and Improve Recovery Following Exercise in Females: A Systematic Review |
| title_fullStr | Supplementation Strategies to Reduce Muscle Damage and Improve Recovery Following Exercise in Females: A Systematic Review |
| title_full_unstemmed | Supplementation Strategies to Reduce Muscle Damage and Improve Recovery Following Exercise in Females: A Systematic Review |
| title_short | Supplementation Strategies to Reduce Muscle Damage and Improve Recovery Following Exercise in Females: A Systematic Review |
| title_sort | supplementation strategies to reduce muscle damage and improve recovery following exercise in females a systematic review |
| topic | EIMD recovery protein blueberries inflammation |
| url | http://www.mdpi.com/2075-4663/4/4/51 |
| work_keys_str_mv | AT jessicalkohne supplementationstrategiestoreducemuscledamageandimproverecoveryfollowingexerciseinfemalesasystematicreview AT michaeljormsbee supplementationstrategiestoreducemuscledamageandimproverecoveryfollowingexerciseinfemalesasystematicreview AT andrewjmckune supplementationstrategiestoreducemuscledamageandimproverecoveryfollowingexerciseinfemalesasystematicreview |