An Update on Self-Amplifying mRNA Vaccine Development
This review will explore the four major pillars required for design and development of an saRNA vaccine: Antigen design, vector design, non-viral delivery systems, and manufacturing (both saRNA and lipid nanoparticles (LNP)). We report on the major innovations, preclinical and clinical data reported...
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2021-01-01
|
| Series: | Vaccines |
| Subjects: | |
| Online Access: | https://www.mdpi.com/2076-393X/9/2/97 |
| _version_ | 1827597243143684096 |
|---|---|
| author | Anna K. Blakney Shell Ip Andrew J. Geall |
| author_facet | Anna K. Blakney Shell Ip Andrew J. Geall |
| author_sort | Anna K. Blakney |
| collection | DOAJ |
| description | This review will explore the four major pillars required for design and development of an saRNA vaccine: Antigen design, vector design, non-viral delivery systems, and manufacturing (both saRNA and lipid nanoparticles (LNP)). We report on the major innovations, preclinical and clinical data reported in the last five years and will discuss future prospects. |
| first_indexed | 2024-03-09T03:27:27Z |
| format | Article |
| id | doaj.art-7e6e71ba07b342fabf2f239a7286cb8c |
| institution | Directory Open Access Journal |
| issn | 2076-393X |
| language | English |
| last_indexed | 2024-03-09T03:27:27Z |
| publishDate | 2021-01-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Vaccines |
| spelling | doaj.art-7e6e71ba07b342fabf2f239a7286cb8c2023-12-03T15:00:35ZengMDPI AGVaccines2076-393X2021-01-01929710.3390/vaccines9020097An Update on Self-Amplifying mRNA Vaccine DevelopmentAnna K. Blakney0Shell Ip1Andrew J. Geall2Michael Smith Laboratories, School of Biomedical Engineering, University of British Columbia, Vancouver, BC V6T 1Z4, CanadaPrecision NanoSystems Inc., Vancouver, BC V6P 6T7, CanadaPrecision NanoSystems Inc., Vancouver, BC V6P 6T7, CanadaThis review will explore the four major pillars required for design and development of an saRNA vaccine: Antigen design, vector design, non-viral delivery systems, and manufacturing (both saRNA and lipid nanoparticles (LNP)). We report on the major innovations, preclinical and clinical data reported in the last five years and will discuss future prospects.https://www.mdpi.com/2076-393X/9/2/97RNAself-amplifying RNArepliconvaccinedrug delivery |
| spellingShingle | Anna K. Blakney Shell Ip Andrew J. Geall An Update on Self-Amplifying mRNA Vaccine Development Vaccines RNA self-amplifying RNA replicon vaccine drug delivery |
| title | An Update on Self-Amplifying mRNA Vaccine Development |
| title_full | An Update on Self-Amplifying mRNA Vaccine Development |
| title_fullStr | An Update on Self-Amplifying mRNA Vaccine Development |
| title_full_unstemmed | An Update on Self-Amplifying mRNA Vaccine Development |
| title_short | An Update on Self-Amplifying mRNA Vaccine Development |
| title_sort | update on self amplifying mrna vaccine development |
| topic | RNA self-amplifying RNA replicon vaccine drug delivery |
| url | https://www.mdpi.com/2076-393X/9/2/97 |
| work_keys_str_mv | AT annakblakney anupdateonselfamplifyingmrnavaccinedevelopment AT shellip anupdateonselfamplifyingmrnavaccinedevelopment AT andrewjgeall anupdateonselfamplifyingmrnavaccinedevelopment AT annakblakney updateonselfamplifyingmrnavaccinedevelopment AT shellip updateonselfamplifyingmrnavaccinedevelopment AT andrewjgeall updateonselfamplifyingmrnavaccinedevelopment |