Pengaruh perlakuan pendahuluan pulse electric field (PEF) pada konvektif kinetika pengeringan dan mikrostruktur daun kelor (Moringa oleifera)

Moringa leaves (Moringa oleifera) are a "Superfood" food ingredient rich in protein, phenolics, amino acids, and unsaturated fatty acids that benefit human health. Consumption in fresh form is prevalent, but the last decade has been plentiful in dry preparations. Pulse Electric Field (PEF)...

Full description

Bibliographic Details
Main Authors: Muhammad Yusuf Rachmadianto, Sukardi Sukardi, Dodyk Pranowo
Format: Article
Language:English
Published: Universitas Trunojoyo Madura 2024-02-01
Series:Agrointek
Subjects:
Online Access:https://journal.trunojoyo.ac.id/agrointek/article/view/17250
_version_ 1797263006611013632
author Muhammad Yusuf Rachmadianto
Sukardi Sukardi
Dodyk Pranowo
author_facet Muhammad Yusuf Rachmadianto
Sukardi Sukardi
Dodyk Pranowo
author_sort Muhammad Yusuf Rachmadianto
collection DOAJ
description Moringa leaves (Moringa oleifera) are a "Superfood" food ingredient rich in protein, phenolics, amino acids, and unsaturated fatty acids that benefit human health. Consumption in fresh form is prevalent, but the last decade has been plentiful in dry preparations. Pulse Electric Field (PEF) is one of the important preliminary treatments in drying vegetables and fruits. Electroporation on Moringa leaves is applied to determine the effectiveness and efficiency of drying on the leaves. The study aimed to determine the effect of PEF treatment before drying on the kinetics of drying and the microstructure of Moringa leaves. PEF treatment is carried out at voltages of 1000V, 1500V, 2000V and without PEF as a control. The treatment during drying was observed at the level of moisture content and effective diffusivity on each of the PEF and control treatments. Experimental data were entered into seven mathematical models and evaluated through Lewis, Page, Modified Page, Logarithmic, Two-term, Wang and Singh, and Simple exponential models. The results of the evaluation of the drying model were selected as the best drying mathematical model on the Logarithmic model. The highest diffusivity effective value at PEF with a voltage of 2000V of 3.25 × 10−9 m2/s. In the microstructure changes of Moringa leaves, the preliminary PEF treatment was conducted using the scanning electron microscope (SEM) test. Moringa leaves with pretreatment PEF 2000V color analysis was lightness (L*), redness (a*), yellowness (b*), and ∆E values of 41.74±0.34a, -8.64±0.28c, 20.16±0.94a, 7.08±0.53c. The results of moringa leaves extract with pretreatment PEF 2000V were total phenols and IC50 values of 55.60±1.24d mg GAE/gram and 76.79±0.77a ppm. Implementing PEF preliminary treatment on drying is expected to accelerate the drying process and maintain a decrease in the quality of the final product of Moringa leaves.
first_indexed 2024-04-25T00:06:09Z
format Article
id doaj.art-b1b1ef215a0a41f4a2b5613d2ed88df4
institution Directory Open Access Journal
issn 1907-8056
2527-5410
language English
last_indexed 2024-04-25T00:06:09Z
publishDate 2024-02-01
publisher Universitas Trunojoyo Madura
record_format Article
series Agrointek
spelling doaj.art-b1b1ef215a0a41f4a2b5613d2ed88df42024-03-14T05:29:42ZengUniversitas Trunojoyo MaduraAgrointek1907-80562527-54102024-02-0118110211110.21107/agrointek.v18i1.172507511Pengaruh perlakuan pendahuluan pulse electric field (PEF) pada konvektif kinetika pengeringan dan mikrostruktur daun kelor (Moringa oleifera)Muhammad Yusuf Rachmadianto0Sukardi Sukardi1Dodyk Pranowo2Teknologi Industri Pertanian, Universitas Brawijaya, MalangTeknologi Industri Pertanian, Universitas Brawijaya, MalangTeknologi Industri Pertanian, Universitas Brawijaya, MalangMoringa leaves (Moringa oleifera) are a "Superfood" food ingredient rich in protein, phenolics, amino acids, and unsaturated fatty acids that benefit human health. Consumption in fresh form is prevalent, but the last decade has been plentiful in dry preparations. Pulse Electric Field (PEF) is one of the important preliminary treatments in drying vegetables and fruits. Electroporation on Moringa leaves is applied to determine the effectiveness and efficiency of drying on the leaves. The study aimed to determine the effect of PEF treatment before drying on the kinetics of drying and the microstructure of Moringa leaves. PEF treatment is carried out at voltages of 1000V, 1500V, 2000V and without PEF as a control. The treatment during drying was observed at the level of moisture content and effective diffusivity on each of the PEF and control treatments. Experimental data were entered into seven mathematical models and evaluated through Lewis, Page, Modified Page, Logarithmic, Two-term, Wang and Singh, and Simple exponential models. The results of the evaluation of the drying model were selected as the best drying mathematical model on the Logarithmic model. The highest diffusivity effective value at PEF with a voltage of 2000V of 3.25 × 10−9 m2/s. In the microstructure changes of Moringa leaves, the preliminary PEF treatment was conducted using the scanning electron microscope (SEM) test. Moringa leaves with pretreatment PEF 2000V color analysis was lightness (L*), redness (a*), yellowness (b*), and ∆E values of 41.74±0.34a, -8.64±0.28c, 20.16±0.94a, 7.08±0.53c. The results of moringa leaves extract with pretreatment PEF 2000V were total phenols and IC50 values of 55.60±1.24d mg GAE/gram and 76.79±0.77a ppm. Implementing PEF preliminary treatment on drying is expected to accelerate the drying process and maintain a decrease in the quality of the final product of Moringa leaves.https://journal.trunojoyo.ac.id/agrointek/article/view/17250drying kineticsmoringa leavesmicrostructurepef
spellingShingle Muhammad Yusuf Rachmadianto
Sukardi Sukardi
Dodyk Pranowo
Pengaruh perlakuan pendahuluan pulse electric field (PEF) pada konvektif kinetika pengeringan dan mikrostruktur daun kelor (Moringa oleifera)
Agrointek
drying kinetics
moringa leaves
microstructure
pef
title Pengaruh perlakuan pendahuluan pulse electric field (PEF) pada konvektif kinetika pengeringan dan mikrostruktur daun kelor (Moringa oleifera)
title_full Pengaruh perlakuan pendahuluan pulse electric field (PEF) pada konvektif kinetika pengeringan dan mikrostruktur daun kelor (Moringa oleifera)
title_fullStr Pengaruh perlakuan pendahuluan pulse electric field (PEF) pada konvektif kinetika pengeringan dan mikrostruktur daun kelor (Moringa oleifera)
title_full_unstemmed Pengaruh perlakuan pendahuluan pulse electric field (PEF) pada konvektif kinetika pengeringan dan mikrostruktur daun kelor (Moringa oleifera)
title_short Pengaruh perlakuan pendahuluan pulse electric field (PEF) pada konvektif kinetika pengeringan dan mikrostruktur daun kelor (Moringa oleifera)
title_sort pengaruh perlakuan pendahuluan pulse electric field pef pada konvektif kinetika pengeringan dan mikrostruktur daun kelor moringa oleifera
topic drying kinetics
moringa leaves
microstructure
pef
url https://journal.trunojoyo.ac.id/agrointek/article/view/17250
work_keys_str_mv AT muhammadyusufrachmadianto pengaruhperlakuanpendahuluanpulseelectricfieldpefpadakonvektifkinetikapengeringandanmikrostrukturdaunkelormoringaoleifera
AT sukardisukardi pengaruhperlakuanpendahuluanpulseelectricfieldpefpadakonvektifkinetikapengeringandanmikrostrukturdaunkelormoringaoleifera
AT dodykpranowo pengaruhperlakuanpendahuluanpulseelectricfieldpefpadakonvektifkinetikapengeringandanmikrostrukturdaunkelormoringaoleifera