Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules.
Epiplakin, a member of the plakin protein family, is exclusively expressed in epithelial tissues and was shown to bind to keratins. Epiplakin-deficient (EPPK-/-) mice showed no obvious spontaneous phenotype, however, EPPK-/- keratinocytes displayed faster keratin network breakdown in response to str...
| Main Authors: | , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Public Library of Science (PLoS)
2014-01-01
|
| Series: | PLoS ONE |
| Online Access: | https://doi.org/10.1371/journal.pone.0108323 |
| _version_ | 1819349639141261312 |
|---|---|
| author | Karl L Wögenstein Sandra Szabo Mariia Lunova Gerhard Wiche Johannes Haybaeck Pavel Strnad Peter Boor Martin Wagner Peter Fuchs |
| author_facet | Karl L Wögenstein Sandra Szabo Mariia Lunova Gerhard Wiche Johannes Haybaeck Pavel Strnad Peter Boor Martin Wagner Peter Fuchs |
| author_sort | Karl L Wögenstein |
| collection | DOAJ |
| description | Epiplakin, a member of the plakin protein family, is exclusively expressed in epithelial tissues and was shown to bind to keratins. Epiplakin-deficient (EPPK-/-) mice showed no obvious spontaneous phenotype, however, EPPK-/- keratinocytes displayed faster keratin network breakdown in response to stress. The role of epiplakin in pancreas, a tissue with abundant keratin expression, was not yet known. We analyzed epiplakin's expression in healthy and inflamed pancreatic tissue and compared wild-type and EPPK-/- mice during caerulein-induced acute pancreatitis. We found that epiplakin was expressed primarily in ductal cells of the pancreas and colocalized with apicolateral keratin bundles in murine pancreatic acinar cells. Epiplakin's diffuse subcellular localization in keratin filament-free acini of K8-deficient mice indicated that its filament-associated localization in acinar cells completely depends on its binding partner keratin. During acute pancreatitis, epiplakin was upregulated in acinar cells and its redistribution closely paralleled keratin reorganization. EPPK-/- mice suffered from aggravated pancreatitis but showed no obvious regeneration phenotype. At the most severe stage of the disease, EPPK-/- acinar cells displayed more keratin aggregates than those of wild-type mice. Our data propose epiplakin to be a protective protein during acute pancreatitis, and that its loss causes impaired disease-associated keratin reorganization. |
| first_indexed | 2024-12-24T19:03:43Z |
| format | Article |
| id | doaj.art-d948532638674358bd06067cd40bb857 |
| institution | Directory Open Access Journal |
| issn | 1932-6203 |
| language | English |
| last_indexed | 2024-12-24T19:03:43Z |
| publishDate | 2014-01-01 |
| publisher | Public Library of Science (PLoS) |
| record_format | Article |
| series | PLoS ONE |
| spelling | doaj.art-d948532638674358bd06067cd40bb8572022-12-21T16:43:09ZengPublic Library of Science (PLoS)PLoS ONE1932-62032014-01-0199e10832310.1371/journal.pone.0108323Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules.Karl L WögensteinSandra SzaboMariia LunovaGerhard WicheJohannes HaybaeckPavel StrnadPeter BoorMartin WagnerPeter FuchsEpiplakin, a member of the plakin protein family, is exclusively expressed in epithelial tissues and was shown to bind to keratins. Epiplakin-deficient (EPPK-/-) mice showed no obvious spontaneous phenotype, however, EPPK-/- keratinocytes displayed faster keratin network breakdown in response to stress. The role of epiplakin in pancreas, a tissue with abundant keratin expression, was not yet known. We analyzed epiplakin's expression in healthy and inflamed pancreatic tissue and compared wild-type and EPPK-/- mice during caerulein-induced acute pancreatitis. We found that epiplakin was expressed primarily in ductal cells of the pancreas and colocalized with apicolateral keratin bundles in murine pancreatic acinar cells. Epiplakin's diffuse subcellular localization in keratin filament-free acini of K8-deficient mice indicated that its filament-associated localization in acinar cells completely depends on its binding partner keratin. During acute pancreatitis, epiplakin was upregulated in acinar cells and its redistribution closely paralleled keratin reorganization. EPPK-/- mice suffered from aggravated pancreatitis but showed no obvious regeneration phenotype. At the most severe stage of the disease, EPPK-/- acinar cells displayed more keratin aggregates than those of wild-type mice. Our data propose epiplakin to be a protective protein during acute pancreatitis, and that its loss causes impaired disease-associated keratin reorganization.https://doi.org/10.1371/journal.pone.0108323 |
| spellingShingle | Karl L Wögenstein Sandra Szabo Mariia Lunova Gerhard Wiche Johannes Haybaeck Pavel Strnad Peter Boor Martin Wagner Peter Fuchs Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules. PLoS ONE |
| title | Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules. |
| title_full | Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules. |
| title_fullStr | Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules. |
| title_full_unstemmed | Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules. |
| title_short | Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules. |
| title_sort | epiplakin deficiency aggravates murine caerulein induced acute pancreatitis and favors the formation of acinar keratin granules |
| url | https://doi.org/10.1371/journal.pone.0108323 |
| work_keys_str_mv | AT karllwogenstein epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT sandraszabo epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT mariialunova epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT gerhardwiche epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT johanneshaybaeck epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT pavelstrnad epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT peterboor epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT martinwagner epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT peterfuchs epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules |