Dracula Defanged: Empowering the Player in Castlevania: Symphony of the Night
The Castlevania games are not designed to scare the player, but they resort to elements from horror literature and film, including references to Bram Stoker’s novel and using characters from monster movies as level bosses. Horror conventions are used as cues to build the gameworld and to understand...
| Main Author: | |
|---|---|
| Other Authors: | |
| Format: | Article |
| Language: | en_US |
| Published: |
Simon Fraser University
2015
|
| Online Access: | http://hdl.handle.net/1721.1/100408 https://orcid.org/0000-0002-1579-2384 |
| _version_ | 1811068615306248192 |
|---|---|
| author | Fernandez-Vara, Clara |
| author2 | Massachusetts Institute of Technology. Program in Comparative Media Studies/Writing |
| author_facet | Massachusetts Institute of Technology. Program in Comparative Media Studies/Writing Fernandez-Vara, Clara |
| author_sort | Fernandez-Vara, Clara |
| collection | MIT |
| description | The Castlevania games are not designed to scare the player, but they resort to elements from horror literature and film, including references to Bram Stoker’s novel and using characters from monster movies as level bosses. Horror conventions are used as cues to build the gameworld and to understand the game design, and how the player appropriates some of those conventions to empower herself in the process.
The article focuses on the figure of the vampire in Castlevania: Symphony of the Night, and how the conventions set in previous media are integrated in the design of the game. Dracula has been divested of his vampiric powers; rather, he acquires typical videogame boss powers, launching fireballs and teleporting himself within the screen. The powers lost by Dracula as a videogame boss are picked up and amplified by the player character, the half-vampire Alucard. This shift is the result of a process started in other media. The powers of the vampire have now been appropriated by the player as a means to empower their interaction in the gameworld, making the vampire a desirable character to the player. |
| first_indexed | 2024-09-23T07:58:34Z |
| format | Article |
| id | mit-1721.1/100408 |
| institution | Massachusetts Institute of Technology |
| language | en_US |
| last_indexed | 2024-09-23T07:58:34Z |
| publishDate | 2015 |
| publisher | Simon Fraser University |
| record_format | dspace |
| spelling | mit-1721.1/1004082024-06-26T21:10:08Z Dracula Defanged: Empowering the Player in Castlevania: Symphony of the Night Fernandez-Vara, Clara Massachusetts Institute of Technology. Program in Comparative Media Studies/Writing Fernandez-Vara, Clara The Castlevania games are not designed to scare the player, but they resort to elements from horror literature and film, including references to Bram Stoker’s novel and using characters from monster movies as level bosses. Horror conventions are used as cues to build the gameworld and to understand the game design, and how the player appropriates some of those conventions to empower herself in the process. The article focuses on the figure of the vampire in Castlevania: Symphony of the Night, and how the conventions set in previous media are integrated in the design of the game. Dracula has been divested of his vampiric powers; rather, he acquires typical videogame boss powers, launching fireballs and teleporting himself within the screen. The powers lost by Dracula as a videogame boss are picked up and amplified by the player character, the half-vampire Alucard. This shift is the result of a process started in other media. The powers of the vampire have now been appropriated by the player as a means to empower their interaction in the gameworld, making the vampire a desirable character to the player. 2015-12-17T12:30:31Z 2015-12-17T12:30:31Z 2010 Article http://purl.org/eprint/type/ConferencePaper 1923-2691 http://hdl.handle.net/1721.1/100408 Fernandez-Vara, Clara. "Dracula Defanged: Empowering the Player in Castlevania: Symphony of the Night." Loading..., Vol. 4, No. 6 (2010). https://orcid.org/0000-0002-1579-2384 en_US http://journals.sfu.ca/loading/index.php/loading/article/viewArticle/88 Loading... Article is made available in accordance with the publisher's policy and may be subject to US copyright law. Please refer to the publisher's site for terms of use. application/pdf Simon Fraser University MIT web domain |
| spellingShingle | Fernandez-Vara, Clara Dracula Defanged: Empowering the Player in Castlevania: Symphony of the Night |
| title | Dracula Defanged: Empowering the Player in Castlevania: Symphony of the Night |
| title_full | Dracula Defanged: Empowering the Player in Castlevania: Symphony of the Night |
| title_fullStr | Dracula Defanged: Empowering the Player in Castlevania: Symphony of the Night |
| title_full_unstemmed | Dracula Defanged: Empowering the Player in Castlevania: Symphony of the Night |
| title_short | Dracula Defanged: Empowering the Player in Castlevania: Symphony of the Night |
| title_sort | dracula defanged empowering the player in castlevania symphony of the night |
| url | http://hdl.handle.net/1721.1/100408 https://orcid.org/0000-0002-1579-2384 |
| work_keys_str_mv | AT fernandezvaraclara draculadefangedempoweringtheplayerincastlevaniasymphonyofthenight |