Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide-MHC
Recent work has demonstrated that nonstimulatory endogenous peptides can enhance T cell recognition of antigen, but MHCI- and MHCII-restricted systems have generated very different results. MHCII-restricted TCRs need to interact with the nonstimulatory peptide–MHC (pMHC), showing peptide specificity...
| Main Authors: | , , , , , , , , , , , |
|---|---|
| Other Authors: | |
| Format: | Article |
| Language: | en_US |
| Published: |
Rockefeller University Press
2014
|
| Online Access: | http://hdl.handle.net/1721.1/89124 https://orcid.org/0000-0003-1268-9602 |
| _version_ | 1811091412476755968 |
|---|---|
| author | Hoerter, John A. H. Brzostek, Joanna Artyomov, Maxim N. Abel, Steven M. Casas, Javier Rybakin, Vasily Ampudia, Jeanette Lotz, Carina Connolly, Janet M. Chakraborty, Arup K. Gould, Keith G. Gascoigne, Nicholas R. J. |
| author2 | Institute for Medical Engineering and Science |
| author_facet | Institute for Medical Engineering and Science Hoerter, John A. H. Brzostek, Joanna Artyomov, Maxim N. Abel, Steven M. Casas, Javier Rybakin, Vasily Ampudia, Jeanette Lotz, Carina Connolly, Janet M. Chakraborty, Arup K. Gould, Keith G. Gascoigne, Nicholas R. J. |
| author_sort | Hoerter, John A. H. |
| collection | MIT |
| description | Recent work has demonstrated that nonstimulatory endogenous peptides can enhance T cell recognition of antigen, but MHCI- and MHCII-restricted systems have generated very different results. MHCII-restricted TCRs need to interact with the nonstimulatory peptide–MHC (pMHC), showing peptide specificity for activation enhancers or coagonists. In contrast, the MHCI-restricted cells studied to date show no such peptide specificity for coagonists, suggesting that CD8 binding to noncognate MHCI is more important. Here we show how this dichotomy can be resolved by varying CD8 and TCR binding to agonist and coagonists coupled with computer simulations, and we identify two distinct mechanisms by which CD8 influences the peptide specificity of coagonism. Mechanism 1 identifies the requirement of CD8 binding to noncognate ligand and suggests a direct relationship between the magnitude of coagonism and CD8 affinity for coagonist pMHCI. Mechanism 2 describes how the affinity of CD8 for agonist pMHCI changes the requirement for specific coagonist peptides. MHCs that bind CD8 strongly were tolerant of all or most peptides as coagonists, but weaker CD8-binding MHCs required stronger TCR binding to coagonist, limiting the potential coagonist peptides. These findings in MHCI systems also explain peptide-specific coagonism in MHCII-restricted cells, as CD4–MHCII interaction is generally weaker than CD8–MHCI. |
| first_indexed | 2024-09-23T15:02:00Z |
| format | Article |
| id | mit-1721.1/89124 |
| institution | Massachusetts Institute of Technology |
| language | en_US |
| last_indexed | 2024-09-23T15:02:00Z |
| publishDate | 2014 |
| publisher | Rockefeller University Press |
| record_format | dspace |
| spelling | mit-1721.1/891242022-10-02T00:05:04Z Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide-MHC Hoerter, John A. H. Brzostek, Joanna Artyomov, Maxim N. Abel, Steven M. Casas, Javier Rybakin, Vasily Ampudia, Jeanette Lotz, Carina Connolly, Janet M. Chakraborty, Arup K. Gould, Keith G. Gascoigne, Nicholas R. J. Institute for Medical Engineering and Science Massachusetts Institute of Technology. Department of Biological Engineering Massachusetts Institute of Technology. Department of Chemical Engineering Massachusetts Institute of Technology. Department of Chemistry Ragon Institute of MGH, MIT and Harvard Abel, Steven M. Chakraborty, Arup K. Recent work has demonstrated that nonstimulatory endogenous peptides can enhance T cell recognition of antigen, but MHCI- and MHCII-restricted systems have generated very different results. MHCII-restricted TCRs need to interact with the nonstimulatory peptide–MHC (pMHC), showing peptide specificity for activation enhancers or coagonists. In contrast, the MHCI-restricted cells studied to date show no such peptide specificity for coagonists, suggesting that CD8 binding to noncognate MHCI is more important. Here we show how this dichotomy can be resolved by varying CD8 and TCR binding to agonist and coagonists coupled with computer simulations, and we identify two distinct mechanisms by which CD8 influences the peptide specificity of coagonism. Mechanism 1 identifies the requirement of CD8 binding to noncognate ligand and suggests a direct relationship between the magnitude of coagonism and CD8 affinity for coagonist pMHCI. Mechanism 2 describes how the affinity of CD8 for agonist pMHCI changes the requirement for specific coagonist peptides. MHCs that bind CD8 strongly were tolerant of all or most peptides as coagonists, but weaker CD8-binding MHCs required stronger TCR binding to coagonist, limiting the potential coagonist peptides. These findings in MHCI systems also explain peptide-specific coagonism in MHCII-restricted cells, as CD4–MHCII interaction is generally weaker than CD8–MHCI. National Institutes of Health (U.S.). Pioneer Award 2014-09-02T14:15:31Z 2014-09-02T14:15:31Z 2013-08 2012-11 Article http://purl.org/eprint/type/JournalArticle 0022-1007 1540-9538 http://hdl.handle.net/1721.1/89124 Hoerter, J. A. H., J. Brzostek, M. N. Artyomov, S. M. Abel, J. Casas, V. Rybakin, J. Ampudia, et al. “Coreceptor Affinity for MHC Defines Peptide Specificity Requirements for TCR Interaction with Coagonist Peptide-MHC.” Journal of Experimental Medicine 210, no. 9 (August 12, 2013): 1807–1821. https://orcid.org/0000-0003-1268-9602 en_US http://dx.doi.org/10.1084/jem.20122528 Journal of Experimental Medicine Creative Commons Attribution-Noncommercial-Share Alike http://creativecommons.org/licenses/by-nc-sa/3.0/ application/pdf Rockefeller University Press Rockefeller University Press |
| spellingShingle | Hoerter, John A. H. Brzostek, Joanna Artyomov, Maxim N. Abel, Steven M. Casas, Javier Rybakin, Vasily Ampudia, Jeanette Lotz, Carina Connolly, Janet M. Chakraborty, Arup K. Gould, Keith G. Gascoigne, Nicholas R. J. Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide-MHC |
| title | Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide-MHC |
| title_full | Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide-MHC |
| title_fullStr | Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide-MHC |
| title_full_unstemmed | Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide-MHC |
| title_short | Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide-MHC |
| title_sort | coreceptor affinity for mhc defines peptide specificity requirements for tcr interaction with coagonist peptide mhc |
| url | http://hdl.handle.net/1721.1/89124 https://orcid.org/0000-0003-1268-9602 |
| work_keys_str_mv | AT hoerterjohnah coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT brzostekjoanna coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT artyomovmaximn coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT abelstevenm coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT casasjavier coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT rybakinvasily coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT ampudiajeanette coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT lotzcarina coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT connollyjanetm coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT chakrabortyarupk coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT gouldkeithg coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT gascoignenicholasrj coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc |